PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4820s0026.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 638aa    MW: 70605.5 Da    PI: 6.1388
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4820s0026.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.11.1e-15455493240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+C+Ckks+Clk+YCeCfaag +C e C+C++C+Nk 
  Araha.4820s0026.1.p 455 SCKRCKCKKSQCLKLYCECFAAGLYCVEPCSCQNCFNKP 493
                          589**********************************96 PP

2TCR46.47.8e-15541579240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          +++gCnC+ks ClkkYCeC   g+ Cs++C+C +CkN  
  Araha.4820s0026.1.p 541 HTRGCNCRKSGCLKKYCECNLMGVRCSSSCRCIGCKNVF 579
                          889**********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.9E-17454495IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.17455580IPR005172CRC domain
PfamPF036385.5E-11457492IPR005172CRC domain
SMARTSM011149.7E-15540581IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.7E-11543577IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MDTPDKNRIS AVSLRNFEYS PVFQYINELS PIEPVKPARP ENILHSLAFT SPSSLFSSPQ  60
INSYRDSRFS IKRHRSLDLS SPLVLIGETV KTSPDAQEGV KISGLCEEQL QCRPAQLANV  120
SETKPFKEQI SLAIELANSL KHARDRCDTQ MISCDEVPMD AENELGGCGG SRELSDELCR  180
HPIDPRDFDD DSDGVHLTEE MEAESGFGSE VIMFDVAGIQ NNEQQIPRTT DPRFYSLASV  240
PQQFSIRCNN SANVLEPGGS CSVQVADGAP DITLSSSSKV AAIVSTSEAE DKEDKDLQPS  300
RKQQSVRRRC LTFDMGGSHK RIPLRDSTND LPLDSTSINK PPSPRKCLDT SKHDTDEILP  360
IPRTIGLHLN GFVNPSVSNG RKKKKFKDGR VFPPTTFHHN NEDEFSTPVS TKRDLVFSDV  420
KIMEAPERSM EGECIDQHMA IENRELSQGL DKLGSCKRCK CKKSQCLKLY CECFAAGLYC  480
VEPCSCQNCF NKPIHEDLVM KSREVIEARN PLAFAPKVVS TSDTAIDLWV ENNKTPASAR  540
HTRGCNCRKS GCLKKYCECN LMGVRCSSSC RCIGCKNVFG HTDEKCAGEA DAVTINDEAK  600
HCGDSRQNEE TSNSERRNRL LLPGSVAFRS LTSLSEL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039260.0BT003926.1 Arabidopsis thaliana clone RAFL15-25-I04 (R20696) unknown protein (At3g04850) mRNA, complete cds.
GenBankBT0050100.0BT005010.1 Arabidopsis thaliana clone U20696 unknown protein (At3g04850) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884473.10.0hypothetical protein ARALYDRAFT_317350
SwissprotQ84JZ80.0TCX4_ARATH; Protein tesmin/TSO1-like CXC 4
TrEMBLD7L2Z30.0D7L2Z3_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_30003660.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148401620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.10.0Tesmin/TSO1-like CXC domain-containing protein